PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT29234
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 312aa    MW: 34294.9 Da    PI: 8.9584
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT29234genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1609.3e-50111471128
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkk........lelee.....vikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
               lppGfrFhP+d+elv +yL+kk+ g              +     ++ +vd++k+ePwdLp+ +  + kewyf+s rd+kyatg+r+nrat+sgyWkatgk
  EMT29234  11 LPPGFRFHPRDDELVLDYLAKKLGGGGgggaaagaA---RvygcpTMVDVDLNKIEPWDLPEIAFIGGKEWYFYSLRDRKYATGQRTNRATESGYWKATGK 108
               79**********************999777665542...15555469**************7666789********************************* PP

       NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
               d+++ + kg lvg++ktLvfy+grapkg+kt+Wvmhe+r 
  EMT29234 109 DRSISR-KGLLVGMRKTLVFYQGRAPKGKKTEWVMHEFRK 147
               ****99.999****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.93E-583170IPR003441NAC domain
PROSITE profilePS5100553.85911170IPR003441NAC domain
PfamPF023654.3E-2512146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MNSLSMVEAR LPPGFRFHPR DDELVLDYLA KKLGGGGGGG AAAGAARVYG CPTMVDVDLN  60
KIEPWDLPEI AFIGGKEWYF YSLRDRKYAT GQRTNRATES GYWKATGKDR SISRKGLLVG  120
MRKTLVFYQG RAPKGKKTEW VMHEFRKEGQ GDLMKLPLKE DWVLCRVFYK TRATVAKPPT  180
GSSYNIDSAA ATSLPPLVDN YIAFDHPGVS TVQNLEGYEQ VPCFSNGPSS HLSSSASMNI  240
PVTAMAPMAG DPEQQHMGKA IKDALSQLTR FEQGNVKREA PAQGGVFAQD GFEYLAESGF  300
LQMWNSLNGF SS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-48717011168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM0275720.0HM027572.1 Triticum aestivum NAC transcription factor 7 (NAC7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563412.10.0PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE62e-87NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLM8C4R30.0M8C4R3_AEGTA; NAC domain-containing protein 21/22
STRINGMLOC_53744.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101237138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.22e-88NAC domain containing protein 1